Sentencedict.com
 Directly to word page Vague search(google)
Home > The missing link in a sentence

The missing link in a sentence

  up(0)  down(0)
Sentence count:27Posted:2018-07-04Updated:2020-07-24
Similar words: processing linemissingreconnaissance missionemissionemissiveremissiondemissionin remission
Random good picture Not show
1. He may be able to provide us with the missing link that can help us solve the mystery.
2. Could this be the missing link in the search for a cure for cancer?
3. Those documents provided the missing link, and the police were able to make an arrest soon after they discovered them.
4. The steam engine was the missing link.
5. The missing link personified is perhaps Zenabou's daughter Salamatu.
6. The missing link is the shareholders.
7. Here the missing link is frequently the directly observed contextual detail which is so crucial in anthropological field work.
8. Garau was the missing link who sold drugs to both Debbie Maxwell and to the shepherds.
9. We had discovered the missing link in the corn bread saga.
10. On this plan, the missing link with Ingleborough Cave, since found, is indicated by a broken line.
11. The modern expression does not include the missing link, spirituality.
12. The missing link is action on trade talks.
13. The crucial flaw in this reasoning is the missing link to monetary policies.
14. Other: This technology will be the missing link between infantry and artillery.
15. A 1816 penny was the missing link in my collection of pennies.
16. It was this " Law of Avogadro'which supplied the missing link in Dalton's Atomic Theory.
17. If you don't have the missing link, you would find that this is contradictory.
18. The 47 million-year-old fossil is the missing link between man and ape as the creature had opposable thumbs, and fingernails.
19. Hyperglycaemia and hyperinsulinemia: is insulin - degrading enzyme the missing link?
20. This uncharted section was finally penetrated after arduous effort in 1983 and the mystery of the missing link solved.
21. David Henshaw of Bristol University says the discovery is the missing link that shows how power lines can cause cancer clusters.
22. Where there is a co-ordination problem the issuing of an authoritative directive can supply the missing link in the argument.
23. Prof Priede said: "These worms are members of a little-known group of animals close to the missing link in evolution between backboned and invertebrate animals.
24. Berry: That was a challenging part of my childhood -- the missing link.
25. If mankind sees you,(sentencedict.com) it will think you are the missing link.
26. It's a criminal act to present the pygmies as the missing link.
27. The Debate on Influencing Doctors'Decisions : Are Drug Characteristics the Missing Link?
More similar words: processing linemissingreconnaissance missionemissionemissiveremissiondemissionin remissionphotoemissioncruise missileanglingmississippi riveremission spectrummississippianhissingganglingbunglingjanglingdanglingnocturnal emissionminglingtinglingjinglingkissingpissingwranglingmississippifiring lineuntanglingkingliness
Total 27, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words